PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV24451.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family SBP
Protein Properties Length: 325aa    MW: 35885.9 Da    PI: 8.506
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV24451.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.61.1e-4024100278
                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                 C v+gC+adls +++yhrrhkvCe+hsk+++v++ g+eqrfCqqCsrfh+l efDe+krsCr+rL++hn+rrrk+q+
  KZV24451.1  24 CLVDGCNADLSLCRDYHRRHKVCEIHSKTAKVTIGGREQRFCQQCSRFHSLVEFDEGKRSCRKRLDGHNRRRRKPQP 100
                 **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.6E-321885IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.6842198IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.8E-3823103IPR004333Transcription factor, SBP-box
PfamPF031104.3E-302497IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MDSSPFPGSS KRAKAPASGS NTHCLVDGCN ADLSLCRDYH RRHKVCEIHS KTAKVTIGGR  60
EQRFCQQCSR FHSLVEFDEG KRSCRKRLDG HNRRRRKPQP DSLSRSSGLI FSTTPAIDSA  120
RILSFGSPQI LPSAVVSSSW AGVTKADSDL MLYNNQHQLN YIERQNSLPQ CSVHSYKGVV  180
NQLPCLQGRD CSFQETSICQ SFLDPSTALG SSNSNQKIFS NGFKQVVDSD RALSLLSSAP  240
SITREFGLNH VDHSEPLPQP HSLVHNLHYS GLNNFAFGQE TKPIVSVTES HGSNASTLHF  300
SETIQHAHEG SSTSGSHQTR TFMWE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-2824971184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18097KRSCRKRLDGHNRRRRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009621034.11e-128PREDICTED: squamosa promoter-binding-like protein 16 isoform X1
RefseqXP_009621035.11e-128PREDICTED: squamosa promoter-binding-like protein 16 isoform X1
RefseqXP_009621036.11e-128PREDICTED: squamosa promoter-binding-like protein 16 isoform X1
RefseqXP_009621037.11e-128PREDICTED: squamosa promoter-binding-like protein 16 isoform X1
RefseqXP_009621038.11e-128PREDICTED: squamosa promoter-binding-like protein 16 isoform X1
RefseqXP_016443563.11e-128PREDICTED: teosinte glume architecture 1-like isoform X1
RefseqXP_016443564.11e-128PREDICTED: teosinte glume architecture 1-like isoform X1
RefseqXP_016443565.11e-128PREDICTED: teosinte glume architecture 1-like isoform X1
RefseqXP_016443566.11e-128PREDICTED: teosinte glume architecture 1-like isoform X1
RefseqXP_016443567.11e-128PREDICTED: teosinte glume architecture 1-like isoform X1
TrEMBLA0A125SZN91e-128A0A125SZN9_TOBAC; Squamosa promoter binding protein NtabSPL13
STRINGPGSC0003DMT4000563731e-126(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49202037
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.15e-45SBP family protein